PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g22030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 791aa    MW: 87737.6 Da    PI: 6.5546
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g22030genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.72.7e-24174275199
                EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   +++++el++
  Tp6g22030 174 FCKTLTASDTSTHGGFSVPRRAAEDCfapldyK-QQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RDEDGELRL 270
                99****************************963.3445679************************************************..5699999** PP

                EEE-S CS
         B3  95 kvfrk 99 
                +++r+
  Tp6g22030 271 GIRRS 275
                **996 PP

2Auxin_resp124.29.1e-41297378182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +a+a+stks+F+v+Y+Pra+++eFv+++ek+ +++++++++G+Rf+m+fe++ds+err++G+v+gv d+dp+rWpnSkWr+L
   Tp6g22030 297 VANAVSTKSMFHVFYSPRATHAEFVIPYEKYITSIRNPICIGTRFRMRFEMDDSPERRCAGVVTGVCDMDPYRWPNSKWRCL 378
                 689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.3E-41165288IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-42168287IPR015300DNA-binding pseudobarrel domain
CDDcd100173.18E-21172274No hitNo description
PfamPF023622.9E-22174275IPR003340B3 DNA binding domain
SMARTSM010193.4E-23174276IPR003340B3 DNA binding domain
PROSITE profilePS5086313.437174276IPR003340B3 DNA binding domain
PfamPF065073.0E-34297378IPR010525Auxin response factor
SuperFamilySSF542774.91E-10666743No hitNo description
PROSITE profilePS5174521.899668750IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 791 aa     Download sequence    Send to blast
MEFDLNTEIA EVEEEENDDG GVVGTRIEKG RLGISLSSSS SCSSGSSSSS SSTASASSIY  60
SELWHACAGP LTSLPKKGNV VVYFPQGHLE QDAMVSYSSP LQTPKFDLHP QLFCRVVNVQ  120
LLANKETDEV YTQVTLLPLQ ECSMQNAEGK EVRELGGDEE RNGSSSVKRT PHMFCKTLTA  180
SDTSTHGGFS VPRRAAEDCF APLDYKQQRP SQELIAKDLH GVEWKFRHIY RGQPRRHLLT  240
TGWSIFVSQK NLVSGDAVLF LRDEDGELRL GIRRSARPRN GLPDSVIEKN SNILSLVANA  300
VSTKSMFHVF YSPRATHAEF VIPYEKYITS IRNPICIGTR FRMRFEMDDS PERRCAGVVT  360
GVCDMDPYRW PNSKWRCLLV RWDESFMSDH QERVSPWEID PSVSLPPLSI QSSPRPKRPW  420
AGLLDTTPPG NPIAGRGGFL DFEESVRPSK VLQGQENIGS ASSLHGFDVM NRRILDFAMQ  480
SHANPVLLSS RVKDRFGEFV DSTSLDPAFS GVMDLDRFPR VLQGQEICSL RAFPQIAGLS  540
PAAASGKPNL GYTDAFAYQA NKSSFYPLES QGIRSTHIPY QNPHNGGDKS SGHPSRAINS  600
TGKTRKFDAQ NEDGLPKNVT ADLPFKIDMM GKQKGGDFNM SASTGCKLFG FSLPVEAPAS  660
NRQSSSKRIC TKVHKQGSLV GRAIDLSRLN GYNDLLTELE RLFNMEGLLR DPEKGWRILY  720
TDSENDMMVV GDDPWHDFCN VVLKIHLYTK EEVENANDDN KSCLEQAALM MEASKSSSVS  780
QPDSSPTVTR V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-115424012354Auxin response factor 1
4ldw_A1e-115424012354Auxin response factor 1
4ldw_B1e-115424012354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808320.0AY080832.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
GenBankAY1139770.0AY113977.1 Arabidopsis thaliana auxin response factor ARF4 (At5g60450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400848.10.0hypothetical protein EUTSA_v10012728mg
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLV4N9650.0V4N965_EUTSA; Auxin response factor
STRINGfgenesh2_kg.8__2008__AT5G60450.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4